Loading...
Statistics
Advertisement

Fotos
www.gccomputertech.com/

Gccomputertech.com

Advertisement
Conversion Technology Metas Server
Gccomputertech.com is hosted in United States / Dallas . Gccomputertech.com uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Gccomputertech.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Gccomputertech.com

SSL certificate

    • name: /OU=Domain Control Validated/OU=EssentialSSL Wildcard/CN=*.biodiversidadezonatampao.st
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: EssentialSSL Wildcard
      • CN: *.biodiversidadezonatampao.st
    • hash: 00985521
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 64554877188943563502485872682019765620
    • validFrom: 150610000000Z
    • validTo: 160609235959Z
    • validFrom_time_t: 1433894400
    • validTo_time_t: 1465516799
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: 98:CC:19:6E:B3:71:A3:3F:74:C0:36:DA:A4:05:05:C8:C5:6A:35:A3
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.biodiversidadezonatampao.st, DNS:biodiversidadezonatampao.st

Meta - Gccomputertech.com

Number of occurences: 1
  • Name:
    Content: 0; url=http://www.gccomputertech.com/gccomputertech/

Server / Hosting

  • IP: 67.228.150.34
  • Latitude: 32.78
  • Longitude: -96.82
  • Country: United States
  • City: Dallas

Rname

  • ns.gccomputertech.com
  • dns1.m6.net
  • dns2.m6.net
  • dns3.m6.net
  • aspmx.l.google.com

Target

  • rakesh.m6.net

HTTP Header Response

HTTP/1.1 200 OK Content-Length: 265 Content-Type: text/html Last-Modified: Thu, 04 Jul 2013 06:18:38 GMT Accept-Ranges: bytes ETag: "b03a3d527e78ce1:0" Server: Microsoft-IIS/7.5 X-Powered-By: ASP.NET Date: Sat, 09 Jul 2016 16:46:35 GMT X-Cache: MISS from s_hp69 X-Cache-Lookup: MISS from s_hp69:80 Via: 1.1 s_hp69 (squid/3.5.19) Connection: keep-alive

DNS

host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 67.228.150.34
host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns.gccomputertech.com
host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns1.m6.net
host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns2.m6.net
host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: dns3.m6.net
host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns.gccomputertech.com
  5. rname: rakesh.m6.net
  6. serial: 2015080902
  7. refresh: 10800
  8. retry: 3600
  9. expire: 604800
  10. minimum-ttl: 86400
host: gccomputertech.com
  1. class: IN
  2. ttl: 86400
  3. type: MX
  4. pri: 0
  5. target: aspmx.l.google.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.ccomputertech.com, www.gsccomputertech.com, www.sccomputertech.com, www.gxccomputertech.com, www.xccomputertech.com, www.gyccomputertech.com, www.yccomputertech.com, www.ghccomputertech.com, www.hccomputertech.com, www.gnccomputertech.com, www.nccomputertech.com, www.gcccomputertech.com, www.cccomputertech.com, www.gdccomputertech.com, www.dccomputertech.com, www.geccomputertech.com, www.eccomputertech.com, www.grccomputertech.com, www.rccomputertech.com, www.gtccomputertech.com, www.tccomputertech.com, www.gbccomputertech.com, www.bccomputertech.com, www.gvccomputertech.com, www.vccomputertech.com, www.gcomputertech.com, www.gcdcomputertech.com, www.gdcomputertech.com, www.gcrcomputertech.com, www.grcomputertech.com, www.gctcomputertech.com, www.gtcomputertech.com, www.gcvcomputertech.com, www.gvcomputertech.com, www.gcfcomputertech.com, www.gfcomputertech.com, www.gcgcomputertech.com, www.ggcomputertech.com, www.gchcomputertech.com, www.ghcomputertech.com, www.gcncomputertech.com, www.gncomputertech.com, www.gcmcomputertech.com, www.gmcomputertech.com, www.gcjcomputertech.com, www.gjcomputertech.com, www.gcomputertech.com, www.gccdomputertech.com, www.gcdomputertech.com, www.gccromputertech.com, www.gcromputertech.com, www.gcctomputertech.com, www.gctomputertech.com, www.gccvomputertech.com, www.gcvomputertech.com, www.gccfomputertech.com, www.gcfomputertech.com, www.gccgomputertech.com, www.gcgomputertech.com, www.gcchomputertech.com, www.gchomputertech.com, www.gccnomputertech.com, www.gcnomputertech.com, www.gccmomputertech.com, www.gcmomputertech.com, www.gccjomputertech.com, www.gcjomputertech.com, www.gccmputertech.com, www.gccobmputertech.com, www.gccbmputertech.com, www.gccohmputertech.com, www.gcchmputertech.com, www.gccogmputertech.com, www.gccgmputertech.com, www.gccojmputertech.com, www.gccjmputertech.com, www.gccommputertech.com, www.gccmmputertech.com, www.gcco mputertech.com, www.gcc mputertech.com, www.gccovmputertech.com, www.gccvmputertech.com, www.gccoputertech.com, www.gccompputertech.com, www.gccopputertech.com, www.gccomoputertech.com, www.gccooputertech.com, www.gccomiputertech.com, www.gccoiputertech.com, www.gccomkputertech.com, www.gccokputertech.com, www.gccom.putertech.com, www.gcco.putertech.com, www.gccomuputertech.com, www.gccouputertech.com, www.gccomjputertech.com, www.gccojputertech.com, www.gccomnputertech.com, www.gcconputertech.com, www.gccom-putertech.com, www.gcco-putertech.com, www.gccomutertech.com, www.gccompiutertech.com, www.gccomiutertech.com, www.gccompkutertech.com, www.gccomkutertech.com, www.gccompuutertech.com, www.gccomuutertech.com, www.gccompjutertech.com, www.gccomjutertech.com, www.gccomplutertech.com, www.gccomlutertech.com, www.gccomptertech.com, www.gccompuwtertech.com, www.gccompwtertech.com, www.gccompuetertech.com, www.gccompetertech.com, www.gccompustertech.com, www.gccompstertech.com, www.gccompuatertech.com, www.gccompatertech.com, www.gccompuertech.com, www.gccomputqertech.com, www.gccompuqertech.com, www.gccomputaertech.com, www.gccompuaertech.com, www.gccomput ertech.com, www.gccompu ertech.com, www.gccomputwertech.com, www.gccompuwertech.com, www.gccomputeertech.com, www.gccompueertech.com, www.gccomputzertech.com, www.gccompuzertech.com, www.gccomputxertech.com, www.gccompuxertech.com, www.gccomputcertech.com, www.gccompucertech.com, www.gccomputrtech.com, www.gccomputexrtech.com, www.gccomputxrtech.com, www.gccomputesrtech.com, www.gccomputsrtech.com, www.gccomputewrtech.com, www.gccomputwrtech.com, www.gccomputerrtech.com, www.gccomputrrtech.com, www.gccomputefrtech.com, www.gccomputfrtech.com, www.gccomputevrtech.com, www.gccomputvrtech.com, www.gccomputecrtech.com, www.gccomputcrtech.com, www.gccomputeqrtech.com, www.gccomputqrtech.com, www.gccomputeartech.com, www.gccomputartech.com, www.gccomputeyrtech.com, www.gccomputyrtech.com, www.gccomputetech.com, www.gccomputeritech.com, www.gccomputeitech.com, www.gccomputerotech.com, www.gccomputeotech.com, www.gccomputerltech.com, www.gccomputeltech.com, www.gccomputerltech.com, www.gccomputeltech.com, www.gccomputer.tech.com, www.gccompute.tech.com,

Other websites we recently analyzed

  1. pennsylvaniamalpracticelawyers.info
    Scottsdale (United States) - 50.63.202.62
    Server software:
    Technology: Html, Html5, Iframe
  2. Pet Kraft
    United States - 208.91.199.87
    Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Html, Javascript, jQuery, Php
    Number of Javascript: 8
    Number of meta tags: 1
  3. califoncoffee.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  4. donateordance.net
    Scottsdale (United States) - 184.168.221.63
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  5. Home
    Studio City (United States) - 205.144.171.109
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 4
    Number of meta tags: 3
  6. 형제천막기업
    Korea, Republic of - 211.49.99.79
    Server software: Apache/2.2.6 (Unix) mod_ssl/2.2.6  PHP/5.2.17
    Technology: CSS, Html, Html5, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 5
  7. windsorsquaremovingsale.com
    Dublin (Ireland) - 79.125.118.219
    Server software:
    Technology: CSS, Html
  8. Serviços e Comunicação Visual - Plotar Mais
    A Plotar Mais é uma empresa nova no mercado que visa prestar serviços de plotagens e comunicação visual com foco em qualidade e desenvolvimento sustentável.
    Houston (United States) - 108.167.188.190
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like button
    Number of Javascript: 2
    Number of meta tags: 6
  9. SD TECHNOLOGIES
    SD Technologies is a technology group that can help you with application development coaching needs.
    Pretoria (South Africa) - 196.38.95.240
    Server software: Microsoft-IIS/7.5
    Technology: Carousel, CSS, Google Font API, Html, Html5, Javascript, jQuery Cycle, jQuery Validate, Php
    Number of Javascript: 19
    Number of meta tags: 4
  10. Ziglioli Arreda
    Arezzo (Italy) - 62.149.140.245
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript, Php, Google Analytics
    Number of Javascript: 5
    Number of meta tags: 1

Check Other Websites